PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_14C563681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 247aa    MW: 28292 Da    PI: 6.6232
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_14C563681.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161764148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed ll ++v+q G g+W+++a+  g++R++k+c++rw +yl
  Traes_4DL_14C563681.1 17 KGPWTALEDRLLTEYVQQQGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 64
                           79********************************************97 PP

2Myb_DNA-binding52.11.5e-1670114147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
  Traes_4DL_14C563681.1  70 RGKITADEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 114
                            8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7011264IPR017930Myb domain
SuperFamilySSF466892.73E-2915111IPR009057Homeodomain-like
SMARTSM007171.8E-131666IPR001005SANT/Myb domain
PfamPF002492.9E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-221871IPR009057Homeodomain-like
CDDcd001677.32E-101964No hitNo description
PROSITE profilePS5129422.94865119IPR017930Myb domain
SMARTSM007171.8E-1569117IPR001005SANT/Myb domain
PfamPF002492.7E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2372117IPR009057Homeodomain-like
CDDcd001674.50E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAMDAMSSAV LQGAWRKGPW TALEDRLLTE YVQQQGEGSW NSVAKLTGLR RSGKSCRLRW  60
VNYLRPDLKR GKITADEETV ILQLHAMLGN RWSAIARCLP GRTDNEIKNY WRTHFKKARP  120
SRRARAQLLH QYQLQQQQQH RQYLHALHLL QQQQQEMQMQ LQMEQQTHQP QVMMMQQQSP  180
PEEDQAVITT VGNMNSMEAA ECYCPCPAAS AVLDLPLPAD DEDALWDSLW RLVDGEDGSS  240
GGDSGEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271011720126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604501e-173EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562106.11e-100PREDICTED: transcription factor WER-like
TrEMBLW5EFE70.0W5EFE7_WHEAT; Uncharacterized protein
STRINGMLOC_9927.21e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-58myb domain protein 305
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]